Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Pig IL23A (Interleukin 23 subunit alpha) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0903K)

This product is a Pig IL23A membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Pig
  • Target Protein
  • IL23A
  • Protein Length
  • Full Length
  • Protein Class
  • Immunity
  • Molecular Weight
  • 26.1 kDa
  • Sequence
  • RAVPEGSSPAWAQGQQLSQQLCTLAWTAHLPMGHVDLPREEGDDETTSEVPHIQCGDGCDPQGLRDNSQSCLQRIHQGLVFYEKLLGSDIFTGEPSLHPDGSVGQLHASLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVAARVFAHGAATLSQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • IL23A
  • Full Name
  • Interleukin 23 subunit alpha
  • Alternative Names
  • IL23A; SGRF; il23p19; IL-23 subunit alpha; IL-23-A; IL-23p19; interleukin 23, alpha subunit p19; interleukin-23 p19 subunit; interleukin-23 subunit p19; Interleukin 23 subunit alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us