Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of BDKRB2
BDKRB2 (also called B2 receptor) is a constitutively expressed bradykinin receptor which mediates the majority of the vascular and metabolic actions of kinins. These B2 receptors are ubiquitously expressed by different cell types, such as vascular endothelial and smooth muscle cells, nonvascular smooth muscle cells of the uterus and intestine, fibroblasts, epithelial cells, various tumor cells, and also on leukocytes and in the central nervous system. The B2 receptors are G protein-coupled, 7-transmembrane-spanning receptors. They signal mainly through Gαq, which stimulates phospholipase C to increase intracellular free calcium.
| Basic Information of BDKRB2 | |
| Protein Name | B2 bradykinin receptor |
| Gene Name | BDKRB2 |
| Aliases | B2R, BK-2 receptor |
| Organism | Homo sapiens (Human) |
| UniProt ID | P30411 |
| Transmembrane Times | 7 |
| Length (aa) | 391 |
| Sequence |
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP IQMENSMGTLRTSISVERQIHKLQDWAGSRQ |
Functions of BDKRB2 Membrane Protein
B2R activated by its endogenous ligand bradykinin participates in various physiological processes including neurogenesis, neuronal differentiation, neuroprotection, and control of inflammation and blood pressure. Studies with B2 receptor knockout mice have shown that the animals develop normally. However, one study found that when animals are fed a high-salt diet, severe hypertension occurs. It has also been reported that the renin-angiotensin system was abnormal (the kallikrein-kinin system and the renin-angiotensin system are antagonistic hemodynamic regulatory systems that play important roles in blood pressure homeostasis) and abnormal renal development occurred. A variety of cardiac defects have also been reported as well as chronically elevated heart rate. A single-nucleotide polymorphism of the BDKRB2 gene promoter, C allele, has been demonstrated to be an independent risk factor for essential hypertension in several ethnic groups. Moreover, several other alleles have been reported and were found to be differentially associated with several disease states.
Fig.1 Human BDKRB2. (Joedicke, 2018)
Applications of BDKRB2 Membrane Protein in Literature
1. Ji B., et al. Neuroprotection of bradykinin/bradykinin B2 receptor system in cerebral ischemia. Biomedicine & Pharmacotherapy. 2017, 94: 1057-1063. PMID: 28810528
This article reported the mechanisms of BK/B2R-mediated neuroprotective effects in the peripheral and central nervous systems.
2. Caetano A L., et al. Kinin B2 receptor can play a neuroprotective role in Alzheimer's disease. Neuropeptides. 2015, 53: 51-62. PMID: 26387425
This study evaluated the participation of B1R and B2R in Aβ peptide-induced cognitive deficits through the evaluation of densities of kinin receptors, synapses, cell bodies and number of Aβ deposits in the brain of three Alzheimer’s disease (AD) models. Study data suggested that B2R displayed a neuroprotective effect and can be regarded as a potential therapeutic target in AD.
3. Luo K., et al. The Risk of bradykinin B2 receptor-58T/C gene polymorphism on hypertension: A meta‐analysis. International Journal of Clinical & Experimental Medicine. 2015, 8(11): 19917-27. PMID: 26884904
This study did a meta-analysis to analyze the relationship between the risk of hypertension and BDKRB2-58T/C gene polymorphism. The results suggested that -58C allele and -58CC genotype increased the risk of hypertension.
4. Rodi D., et al. Bradykinin B 2, receptors increase hippocampal excitability and susceptibility to seizures in mice. Neuroscience. 2013, 248(38): 392-402. PMID: 23811399
This study used two different models to investigate the susceptibility to seizures of B1 knockout (KO) and B2 KO mice. The results showed that B2 receptors might have a role in the responsiveness to epileptogenic insults and/or in the early period of epileptogenesis.
BDKRB2 Preparation Options
In vitro studies of membrane proteins to access their structure and function information is essential to a wide range of biomedical and biotechnological applications. With our robust and versatile Magic™ Membrane Protein Platform, Creative Biolabs is capable of preparing purified, stabilized, and functional membrane proteins of different formats. It is accomplished by the use of different reconstitution systems, such as detergent micelles, bicelles, liposomes, amphipols, etc. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-BDKRB2 antibody development services.
As a company committed to providing innovative solutions for membrane protein studies, Creative Biolabs has built its expertise on more than a decade of technology development. Our mission is to provide membrane protein related products and services that advance our customers’ scientific objectives. contact us to experience the great value of our excellent services.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
