Close

CLIC1 Membrane Protein Introduction

Introduction of CLIC1

Chloride intracellular channel protein 1 (CLIC1) is a protein that in humans is encoded by the CLIC1 gene. CLIC1 is located on human chromosome 6p21.3, with a total length of 1, 223 base pairs that encode a 241-amino acid ion channel protein.

Chloride channels are a diverse group of proteins which regulate basic cellular processes. Chloride channels stabilize cell membrane potential, transepithelial transport, maintain intracellular pH, and regulating cell volume. CLIC1, primarily localized in the cell nucleus is a member of the p64 family. It exhibits both nuclear and plasma membrane chloride ion channel activity. CLIC1 can be inserted into the membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion appears to be redox-regulated and may occur only under oxidizing conditions. CLIC1 is also involved in the regulation of cell cycle.

Basic Information of CLIC1
Protein Name Chloride intracellular channel protein 1
Gene Name CLIC1
Aliases Chloride channel ABP, Nuclear chloride ion channel 27, NCC27, Regulatory nuclear chloride ion channel protein, hRNCC, G6, NCC27
Organism Homo sapiens (Human)
UniProt ID O00299
Transmembrane Times 1
Length (aa) 241
Sequence MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Function of CLIC1 Membrane Protein

CLIC1 may play a critical role both in the normal physiological cell states and tumor development because it is expressed in the cell nucleus, cytoplasm and cell membrane. CLIC1 may be involved in the physiological cell state, such as changes in cell volume, regulation of membrane potential, acidification of intracellular organelles, proliferation and differentiation of cells and cell cycle progression. However, the abnormal expression of CLIC1 may result in abnormal physiological regulation. It may affect the occurrence and development of tumors, especially in terms of invasion and metastasis. Several diseases are associated with CLIC1, including blackwater fever and hyperornithinemia-hyperammonemia-homocitrullinuria syndrome. Early studies have demonstrated the role of CLIC1 in the invasion and metastasis in several malignant tumor types, such as colorectal cancer, liver cancer, and prostate cancer.

CLIC1 Membrane Protein IntroductionFig.1 Structure of the CLIC1 protein.

Application of CLIC1 Membrane Protein in Literature

  1. Li B.P., et al. CLIC1 promotes the progression of gastric cancer by regulating the MAPK/AKT pathways. Cell Physiol Biochem. 2018, 46(3): 907-924. PubMed ID: 29669336

    This article focuses on the effects of CLIC1 on the progression of GC in vivo and in vitro and the potential underlying mechanisms. It shows that CLIC1 promotes the progression of gastric cancer by regulating the MAPK/AKT pathways.

  2. Yu W., et al. MtHsp70-CLIC1-pulsed dendritic cells enhance the immune response against ovarian cancer. Biochem Biophys Res Commun. 2017, 494(1-2): 13-19. PubMed ID: 29061300

    The article points out that CLIC1 is a possible tumor marker for ovarian cancer and DCs pulsed with MtHsp70-CLIC1 can enhance the anti-tumor immunity against OC.

  3. Zhou N., et al. Decreased expression of hsa-miR-372 predicts poor prognosis in patients with gallbladder cancer by affecting chloride intracellular channel 1. Mol Med Rep. 2017, 16(5): 7848-7854. PubMed ID: 28944858

    This article reports that CLIC1 may be a direct target gene of hsa-miR-372. Down-regulation of hsa-miR-372 can occur in the GBC tissues, which may be related to the aggressive and progressive tumor behavior by affecting the expression of CLIC1.

  4. Liu Y., et al. Chloride intracellular channel 1 regulates the antineoplastic effects of metformin in gallbladder cancer cells. Cancer Sci. 2017, 108(6): 1240-1252. PubMed ID: 28378944

    Authors in this group have found that either dysfunction or downregulation of CLIC1 can partially decrease the antineoplastic effects of metformin while upregulation of CLIC1 can increase drug sensitivity.

  5. Ulmasov B., et al. CLIC1 null mice demonstrate a role for CLIC1 in macrophage superoxide production and tissue injury. Physiol Rep. 2017, 5(5). PubMed ID: 28275112

    The article reveals that CLIC1 supports redistribution of NADPH oxidase to the plasma membrane in macrophage superoxide production.

CLIC1 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-CLIC1 antibody development services.


As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and helps you with the research of membrane proteins. Please do not hesitate to inquire us for more details.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us