Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Human NAT8 Membrane Protein Expressed in Wheat Germ, Full Length (CAT#: S01YF-0224-KX546)

This product is recombinant Human NAT8 protein.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NAT8
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • Molecular Weight
  • 50.71 kDa
  • TMD
  • 1
  • Sequence
  • MAPCHVRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSQ

Product Description

  • Expression Systems
  • Wheat Germ Cell-free Expression System
  • Tag
  • GST tag at N-terminal
  • Protein Format
  • Soluble
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • NAT8
  • Full Name
  • N-acetyltransferase 8 (putative)
  • Introduction
  • This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
  • Alternative Names
  • NAT8; GLA; CML1; CCNAT; Hcml1; ATase2; TSC501; TSC510; N-acetyltransferase 8; acetyltransferase 2; camello-like protein 1; cysteinyl-conjugate N-acetyltransferase; kidney- and liver-specific gene product; probable N-acetyltransferase 8; N-acetyltransferase 8 (putative)
  • Gene ID
  • 9027
  • UniProt ID
  • Q9UHE5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us