Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Human SCN2A Membrane Protein Expressed in Wheat Germ, AA 237-362 (CAT#: S01YF-0724-PY1)

This product is recombinant Human SCN2A protein. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SCN2A
  • Protein Length
  • Partial (AA237-362)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 35.64 kDa
  • Sequence
  • NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCG
    NSSDAGQCPEGYICVKAGRNPNY

Product Description

  • Expression Systems
  • Wheat Germ expression system
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • 50 mM Tris-HCl, 100 mM reduced Glutathione, pH 8.0

Target

  • Target Protein
  • SCN2A
  • Full Name
  • Sodium channel protein type 2 subunit alpha
  • Introduction
  • SCN2A Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient.
  • Alternative Names
  • EA9; HBA; NAC2; BFIC3; BFIS3; BFNIS; DEE11; HBSCI; EIEE11; HBSCII; Nav1.2; SCN2A1; SCN2A2; Na(v)1.2
  • Gene ID
  • 6326
  • UniProt ID
  • Q99250

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us