Close
Close

Magic™ Membrane Protein Human CCR7 (C-C motif chemokine receptor 7) expressed in E.coli for Antibody Discovery (CAT#: MP1336J)

Datasheet
This product is human CCR7 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR7
  • Protein Length
  • Partial (25-378aa)
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYI YFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGM LLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSS EQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKV IIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPF LYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR7
  • Full Name
  • C-C motif chemokine receptor 7
  • Introduction
  • The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • BLR 2; BLR2; C C chemokine receptor type 7; C C CKR 7; C-C chemokine receptor type 7; C-C CKR-7; CC chemokine receptor 7; CC chemokine receptor type 7; CC CKR 7; CC-CKR-7; CCCKR7; CCR 7; CCR-7; Ccr7; CCR7_HUMAN; CD 197; CD197; CD197 antigen; CDw197; Chemokine (C C motif) receptor 7; Chemokine (C C) receptor 7; Chemokine C C motif receptor 7; Chemokine C C receptor 7; Chemokine receptor 7; Chemokine receptor 7-like protein; CMKBR7; EBI 1; EBI1; Ebi1h; EBV Induced G Protein Coupled Receptor 1; EBV-induced G-protein coupled receptor 1; Epstein Barr virus induced G protein coupled receptor; Epstein Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; EVI 1; EVI1; Lymphocyte Specific G Protein Coupled Peptide Receptor; MGC108519; MIP 3 beta receptor; MIP-3 beta receptor; MIP3 Beta Receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us