Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD5 (Frizzled class receptor 5) Expressed in NS0 for Antibody Discovery, Partial (27-167aa) (CAT#: MPX0027K)

This product is a 42.5 kDa Human FZD5 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD5
  • Protein Length
  • Partial (27-167aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 42.5 kDa
  • TMD
  • 7
  • Sequence
  • ASKAPVCQEITVPMCRGIGYNLTH
    MPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHK
    PLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDY
    NRSEATTAPPRPFPAKP

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in sterile PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • FZD5
  • Full Name
  • Frizzled class receptor 5
  • Introduction
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
  • Alternative Names
  • HFZ5; C2orf31; frizzled-5; Wnt receptor; frizzled 5, seven transmembrane spanning receptor; frizzled family receptor 5; fz-5; fzE5; seven-transmembrane receptor frizzled-5; FZD5; Frizzled class receptor 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us