Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human FZD9 (Frizzled class receptor 9) Expressed in HEK293 for Antibody Discovery, Partial (23-185aa) (CAT#: MPX0030K)

This product is a 44 kDa Human FZD9 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FZD9
  • Protein Length
  • Partial (23-185aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 44 kDa
  • TMD
  • 7
  • Sequence
  • LEIGRFDPERGRGAAPCQAVEIPMCRGI
    GYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMC
    TDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHA
    LCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.1 EU/μg by the LAL method
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • FZD9
  • Full Name
  • Frizzled class receptor 9
  • Introduction
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD9 gene is located within the Williams syndrome common deletion region of chromosome 7, and heterozygous deletion of the FZD9 gene may contribute to the Williams syndrome phenotype. FZD9 is expressed predominantly in brain, testis, eye, skeletal muscle, and kidney.
  • Alternative Names
  • frizzled 9, seven transmembrane spanning receptor; frizzled family receptor 9; frizzled homolog 9; fz-9; fzE6; hFz9; FZD3; CD349; frizzled-9; FZD9; Frizzled class receptor 9

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us