Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human HTR1D (5-hydroxytryptamine receptor 1D) Expressed in E.coli with 6xHis and KSI tag at the N-terminus for Antibody Discovery, Partial (1-38aa) (CAT#: MPX4199K)

This product is a 19.5 kDa Human HTR1D membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HTR1D
  • Protein Length
  • Partial (1-38aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 19.5 kDa
  • TMD
  • 7
  • Sequence
  • MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and KSI tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • HTR1D
  • Full Name
  • 5-hydroxytryptamine receptor 1D
  • Alternative Names
  • HTRL; RDC4; HT1DA; 5-HT1D; HTR1DA; 5-HT-1D; 5-HT-1D-alpha; 5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled; serotonin 1D alpha receptor; serotonin receptor 1D; HTR1D; 5-hydroxytryptamine receptor 1D

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us