Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Antirrhinum majus (Garden snapdragon) DIP (Probable aquaporin TIP-type) for Antibody Discovery (CAT#: MP1449J)

This product is a 25.2 kDa Antirrhinum majus (Garden snapdragon) DIP membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Antirrhinum majus (Garden snapdragon)
  • Target Protein
  • DIP
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 25.2 kDa
  • TMD
  • 6
  • Sequence
  • MVKIAFGSIGDSFSVASIKAYVAEFIATLLFVFAGVGSAIAYNKLTSDAALDPAGLVAVAVAHAFALFVGVSMAANVSGGHLNPAVTLGLAVGGNITILTGLFYWIAQCLGSTVACLLLKFVTNGLSVPTHGVAAGMDAIQGVVMEIIITFALVYTVYATAADPKKGSLGVIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVASGDFSQNWIYWAGPLIGGALAGFIYGDVFITAHAPLPTSEDYA

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DIP
  • Full Name
  • Probable aquaporin TIP-type
  • Introduction
  • Channel protein in tonoplast. These proteins may allow the diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm (By similarity).
  • Alternative Names
  • DIP; Probable aquaporin TIP-type; Dark intrinsic protein; Tonoplast intrinsic protein DiP

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us