Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Arabidopsis thaliana (Mouse-ear cress) TIP2;3 (Tonoplast intrinsic protein 2;3) for Antibody Discovery (CAT#: MP1469J)

This product is a 25.2 kDa Arabidopsis thaliana (Mouse-ear cress) TIP2;3 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Arabidopsis thaliana (Mouse-ear cress)
  • Target Protein
  • TIP2;3
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 25.2 kDa
  • TMD
  • 6
  • Sequence
  • MVKIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSYEAVETREIRV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TIP2;3
  • Full Name
  • Tonoplast intrinsic protein 2;3
  • Introduction
  • Transports methylammonium or ammonium in yeast cells, preferentially at high medium pH. May participate in vacuolar compartmentation and detoxification of ammonium.
  • Alternative Names
  • TIP2-3; At5g47450; MNJ7.4; Aquaporin TIP2-3; Tonoplast intrinsic protein 2-3; AtTIP2;3; ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3; ATTIP2;3; DELTA-TIP3; DELTA-TONOPLAST INTRINSIC PROTEIN 3; MNJ7.4; MNJ7_4; tonoplast intrinsic protein 2;3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us