Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Bordetella parapertussis aqpZ (Aquaporin Z) for Antibody Discovery (CAT#: MP1446J)

This product is a 24 kDa Bordetella parapertussis (strain 12822 / NCTC 13253) aqpZ membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Bordetella parapertussis
  • Target Protein
  • aqpZ
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 24 kDa
  • TMD
  • 6
  • Sequence
  • MQPLFKRCGAEFFGTFWLVLGGCGSAVLAAGVPQVGIGYAGVALAFGLTVLTMAYAVGHISGGHFNPAVTVGLAASGRFGWRDVPPYIVAQVVGAIVAAATLASIAQGVAGFDLVASKFAANGYGDHSPGKYSMQAALICEIVLSAGFVFVILGATDKRAPAGFAPIPIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALEQLWLFWLAPIAGALVGALAYRLVGTPSAQR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • aqpZ
  • Full Name
  • Aquaporin Z
  • Introduction
  • Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.
  • Alternative Names
  • aqpZ; BPP1958Aquaporin Z

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us