Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SEC61G (SEC61 translocon subunit gamma) Full Length (CAT#: MPC1913K) Made to Order

This product is a 7.7 kDa Human SEC61G membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SEC61G
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 7.7 kDa
  • TMD
  • 1
  • Sequence
  • MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFI
    GFFVKLIHIPINNIIVGG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SEC61G
  • Full Name
  • SEC61 translocon subunit gamma
  • Introduction
  • The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the gamma-subunit protein. Alternatively spliced transcript variants encoding the same protein have been identified.
  • Alternative Names
  • SEC61G; SSS1; protein transport protein Sec61 subunit gamma; SEC61 translocon gamma subunit; Sec61 gamma subunit; protein transport protein SEC61 gamma subunit; SEC61 translocon subunit gamma

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us