Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Drosophila melanogaster (Fruit fly) Drip (Drosophila melanogaster Aquaporin (Drip)) for Antibody Discovery (CAT#: MP1450J)

This product is a 25.6 kDa Drosophila melanogaster (Fruit fly) Drip membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Drosophila melanogaster (Fruit fly)
  • Target Protein
  • Drip
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 25.6 kDa
  • TMD
  • 6
  • Sequence
  • MVEKTEMSKFVGVADITENKKIWRMLLGELVGTFFLIFVGVGSTTSGSVPQIAFTFGLTVATIAQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAVIKVALDGVAGGDLGVSSFDPSLNCAQAVLIEALITFILVFVVKAVSDPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWTYHWVYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Drip
  • Full Name
  • Drosophila melanogaster Aquaporin (Drip)
  • Introduction
  • Forms a water-specific channel.
  • Alternative Names
  • Drip; CG9023Aquaporin; anon-48Aa; CG9023; Dmel\CG9023; drip; DRIP; I

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us