Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein E.coli col (NEWENTRY) Expressed in vitro E.coli expression system for Antibody Discovery, Partial (74-180aa) (CAT#: MPX0842K)

This product is a 24.8 kDa E.coli col membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • E.coli
  • Target Protein
  • col
  • Protein Length
  • Partial (74-180aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 24.8 kDa
  • Sequence
  • LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • col
  • Full Name
  • NEWENTRY
  • Alternative Names
  • col; NEWENTRY

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us