Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein E. coli CRCP (CGRP receptor component) for Antibody Discovery (CAT#: MP0266X)

This product is a 19 kDa E. coli CRCP membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • E. coli
  • Target Protein
  • CRCP
  • Protein Length
  • Full-length
  • Molecular Weight
  • 19 kDa
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Product Description

  • Application
  • SDS-PAGE
  • Expression Systems
  • E. coli
  • Tag
  • Escherichia coli
  • Purification
  • Conventional Chromatography
  • Purity
  • > 95% by SDS-PAGE
  • Buffer
  • 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol)

Target

  • Target Protein
  • CRCP
  • Full Name
  • CGRP receptor component
  • Introduction
  • This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized
  • Alternative Names
  • CGRP-RCP; MGC111194; RCP; RCP9; calcitonin gene-related peptide-receptor component protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us