Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Escherichia coli ymfR (E14 prophage; IPR020297 domain-containing protein YmfR) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0991K)

This product is a Escherichia coli ymfR membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Escherichia coli
  • Target Protein
  • ymfR
  • Protein Length
  • Full Length
  • Protein Class
  • Bacteriocin
  • TMD
  • 2
  • Sequence
  • MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ymfR
  • Full Name
  • E14 prophage; IPR020297 domain-containing protein YmfR
  • Introduction
  • YmfR is a conserved 60 aa phage protein of unknown function that is located between terminase and portal genes of e14, a position and length that is analagous to the 68 aa lambda W head-tail joining protein.
  • Alternative Names
  • ymfR; ECK1136; Uncharacterized protein YmfR; E14 prophage; IPR020297 domain-containing protein YmfR

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us