Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein HCoV-NL63 E (Envelope protein) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0865K)

This product is a HCoV-NL63 E membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • HCoV-NL63
  • Target Protein
  • E
  • Protein Length
  • Full Length
  • Protein Class
  • Virus
  • Molecular Weight
  • 12.0 kDa
  • TMD
  • 1
  • Sequence
  • MFLRLIDDNGIVLNSILWLLVMIFFFVLAMTFIKLIQLCFTCHYFFSRTLYQPVYKIFLAYQDYMQIAPVPAEVLNV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • E
  • Full Name
  • Envelope protein
  • Alternative Names
  • E; E protein; sM protein; Envelope small membrane protein; Envelope protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us