Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ACKR2 (Atypical chemokine receptor 2) Full Length (CAT#: MPC1036K) Made to Order

This product is a 43.4 kDa Human ACKR2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ACKR2
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 43.4 kDa
  • TMD
  • 7
  • Sequence
  • MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLP
    VFYSLIFVLGLSGNLLLLMVLLRYVPRRRMVEIYLLNLAISNLLFLVTLP
    FWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQ
    PYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFG
    GHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALK
    IAAALVVAFFVLWFPYNLTLFLHTLLDLQVFGNCEVSQHLDYALQVTESI
    AFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES
    SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • ACKR2
  • Full Name
  • Atypical chemokine receptor 2
  • Introduction
  • This gene encodes a beta chemokine receptor, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptor-mediated signal transduction are critical for the recruitment of effector immune cells to the inflammation site. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes.
  • Alternative Names
  • ACKR2; D6; hD6; CCR9; CCBP2; CCR10; CMKBR9; C-C chemokine receptor D6; CC-chemokine-binding receptor JAB61; chemokine (C-C motif) receptor 9; chemokine (C-C) receptor 9; chemokine receptor CCR-10; chemokine receptor CCR-9; chemokine receptor D6; chemokine-binding protein 2; chemokine-binding protein D6; Atypical chemokine receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us