Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ADGRF4 (Adhesion G protein-coupled receptor F4) Expressed in CHO for Antibody Discovery, Partial (22-347aa) (CAT#: MPX0309K)

This product is a 37 kDa Human ADGRF4 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADGRF4
  • Protein Length
  • Partial (22-347aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 37 kDa
  • TMD
  • 7
  • Sequence
  • SHYRSKIHLKAGDKLQSPEGKPKTGRIQE
    KCEGPCISSSNCSQPCAKDFHGEIGFTCNQKKWQKSAETCTSLSVEKLFK
    DSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPFDYACITDMV
    KSSETTSGNIAFIVELLKNISTDLSDNVTREKMKSYSEVANHILDTAAIS
    NWAFIPNKNASSDLLQSVNLFARQLHIHNNSENIVNELFIQTKGFHINHN
    TSEKSLNFSMSMNNTTEDILGMVQIPRQELRKLWPNASQAISIAFPTLGA
    ILREAHLQNVSLPRQVNGLVLSVVLPERLQEIILTFEKINKTRNARA

Product Description

  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 200 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ADGRF4
  • Full Name
  • Adhesion G protein-coupled receptor F4
  • Introduction
  • Sequence analysis of this gene suggests that it is encodes a member of the superfamily of G protein-couple receptors. G protein-coupled receptors typically contain seven hydrophobic transmembrane domains, interact with guanine nucleotide binding regulatory proteins, and detect molecules outside the cell and act to transduce these signals into intracellular responses. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • ADGRF4; PGR18; GPR115; G-protein coupled receptor PGR18; probable G-protein coupled receptor 115; seven transmembrane helix receptor; Adhesion G protein-coupled receptor F4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us