Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human AFG3L2 (AFG3 like matrix AAA peptidase subunit 2) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (550-759aa) (CAT#: MPX4429K)

This product is a 50.8kDa Human AFG3L2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AFG3L2
  • Protein Length
  • Partial (550-759aa)
  • Protein Class
  • Protease
  • Molecular Weight
  • 50.8kDa
  • TMD
  • 2
  • Sequence
  • ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • AFG3L2
  • Full Name
  • AFG3 like matrix AAA peptidase subunit 2
  • Introduction
  • This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
  • Alternative Names
  • AFG3L2; OPA12; SCA28; SPAX5; AFG3-like protein 2; AFG3 ATPase family gene 3-like 2; AFG3 ATPase family member 3-like 2; AFG3 like AAA ATPase 2; ATPase family gene 3, yeast; paraplegin-like protein; AFG3 like matrix AAA peptidase subunit 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us