Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human AGER (Advanced glycosylation end-product specific receptor) Expressed in NS0 for Antibody Discovery, Partial (24-344aa) (CAT#: MPX0177K)

This product is a 61 kDa Human AGER membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AGER
  • Protein Length
  • Partial (24-344aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 61 kDa
  • TMD
  • 1
  • Sequence
  • QNITARIGEPLVLKCKGAPKKPPQRLE
    WKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQ
    AMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSY
    PAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGG
    DPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVA
    PGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
    CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • AGER
  • Full Name
  • Advanced glycosylation end-product specific receptor
  • Introduction
  • The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene.
  • Alternative Names
  • AGER; RAGE; sRAGE; SCARJ1; advanced glycosylation end product-specific receptor; receptor for advanced glycation end-products variant 20; Advanced glycosylation end-product specific receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us