Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MIP (Major intrinsic protein of lens fiber) Full Length (CAT#: MPC1983K) Made to Order

This product is a 28.1 kDa Human MIP membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MIP
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 28.1 kDa
  • TMD
  • 8
  • Sequence
  • MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGL
    ALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAG
    AAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYD
    ERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTN
    HWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPE
    VTGEPVELNTQAL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • MIP
  • Full Name
  • Major intrinsic protein of lens fiber
  • Introduction
  • Major intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13.
  • Alternative Names
  • MIP; AQP0; LIM1; MP26; MIP26; CTRCT15; lens fiber major intrinsic protein; aquaporin 0; Major intrinsic protein of lens fiber

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us