Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human AGPAT1 (1-acylglycerol-3-phosphate O-acyltransferase 1) Full Length (CAT#: MPC4270K) Made to Order

This product is a made-to-order Human AGPAT1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AGPAT1
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 2
  • Sequence
  • MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAV
    LAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVV
    VSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRK
    RTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQ
    AQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPAL
    ADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • AGPAT1
  • Full Name
  • 1-acylglycerol-3-phosphate O-acyltransferase 1
  • Introduction
  • This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein.
  • Alternative Names
  • AGPAT1; G15; LPAATA; 1-AGPAT1; LPAAT-alpha; 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-AGP acyltransferase 1; 1-AGPAT 1; 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase); 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha); epididymis secretory sperm binding protein; lysophosphatidic acid acyltransferase alpha; lysophospholipid acyltransferase; 1-acylglycerol-3-phosphate O-acyltransferase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us