Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human AMN (Amnion associated transmembrane protein) Expressed in NS0 for Antibody Discovery, Partial (20-358aa) (CAT#: MPX0181K)

This product is a 37.2 kDa Human AMN membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AMN
  • Protein Length
  • Partial (20-358aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 37.2 kDa
  • TMD
  • 1
  • Sequence
  • VSKLWVPNTDFDVAANWSQNRTPCAGGAVEF
    PADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGE
    PAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASF
    RVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSV
    GPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACHSALRPQGQCC
    DLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPRSSRL
    READTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG
    AHVWGSSA

Product Description

  • Expression Systems
  • NS0
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • AMN
  • Full Name
  • Amnion associated transmembrane protein
  • Introduction
  • The protein encoded by this gene is a type I transmembrane protein. It is thought to modulate bone morphogenetic protein (BMP) receptor function by serving as an accessory or coreceptor, and thus facilitates or hinders BMP binding. It is known that the mouse AMN gene is expressed in the extraembryonic visceral endoderm layer during gastrulation, but it is found to be mutated in amnionless mouse. The encoded protein has sequence similarity to short gastrulation (Sog) and procollagen IIA proteins in Drosophila.
  • Alternative Names
  • AMN; IGS2; PRO1028; amnionless; protein amnionless; amnionless homolog; visceral endoderm-specific type 1 transmembrane protein; Amnion associated transmembrane protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us