Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ANTXR2 (ANTXR cell adhesion molecule 2) Expressed in HEK293 for Antibody Discovery, Partial (34-317aa) (CAT#: MPX0530K)

This product is a 57 kDa Human ANTXR2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ANTXR2
  • Protein Length
  • Partial (34-317aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 57 kDa
  • TMD
  • 1
  • Sequence
  • QEQPSCRRAFDLYFVLD
    KSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRG
    KISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGK
    LDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVK
    GGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRN
    GSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGG
    KSVISGSLIVTATECSN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • ANTXR2
  • Full Name
  • ANTXR cell adhesion molecule 2
  • Introduction
  • This gene encodes a receptor for anthrax toxin. The protein binds to collagen IV and laminin, suggesting that it may be involved in extracellular matrix adhesion. Mutations in this gene cause juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ANTXR2; HFS; ISH; JHF; CMG2; CMG-2; anthrax toxin receptor 2; capillary morphogenesis gene 2 protein; capillary morphogenesis protein 2; ANTXR cell adhesion molecule 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us