Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human APOLD1 (Apolipoprotein L domain containing 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0873K)

This product is a Human APOLD1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • APOLD1
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 33.4 kDa
  • TMD
  • 3
  • Sequence
  • MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute protein in deionized sterile water
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • APOLD1
  • Full Name
  • Apolipoprotein L domain containing 1
  • Introduction
  • APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function.
  • Alternative Names
  • APOLD1; VERGE; apolipoprotein L domain-containing protein 1; vascular early response gene protein; Apolipoprotein L domain containing 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us