Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ATP1B4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide; OTTHUMP00000023940; X,K-ATPase beta-m subunit; BetaM; Na,K-ATPase beta m-subunit; X,K-ATPase beta-m subunit; x/potassium-transporting ATPase subunit beta-m) for Antibody Discovery (CAT#: MP0335J)

This product is a 40.9 kDa Human ATP1B4 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP1B4
  • Protein Length
  • Full-length
  • Protein Class
  • Transmembrane
  • Molecular Weight
  • 40.9 kDa
  • TMD
  • 1
  • Sequence
  • MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE
    EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT
    FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNED
    EDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISY
    YPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLN
    IET

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • ATP1B4
  • Full Name
  • ATPase, (Na+)/K+ transporting, beta 4 polypeptide; OTTHUMP00000023940; X,K-ATPase beta-m subunit; BetaM; Na,K-ATPase beta m-subunit; X,K-ATPase beta-m subunit; x/potassium-transporting ATPase subunit beta-m
  • Introduction
  • This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ATPase, (Na+)/K+ transporting, beta 4 polypeptide; OTTHUMP00000023940; X,K-ATPase beta-m subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us