Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human B3GAT1 (Beta-1,3-glucuronyltransferase 1) Expressed in CHO for Antibody Discovery, Partial (25-334aa) (CAT#: MPX0591K)

This product is a 36 kDa Human B3GAT1 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • B3GAT1
  • Protein Length
  • Partial (25-334aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 36 kDa
  • TMD
  • 1
  • Sequence
  • HQSTLAPLLAVHKDEGSDPRRETPPG
    ADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKA
    ELTRMANTLLHVPNLHWLVVEDAPRRTPLTARLLRDTGLNYTHLHVETPR
    NYKLRGDARDPRIPRGTMQRNLALRWLRETFPRNSSQPGVVYFADDDNTY
    SLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVGWKTVFDPHRP
    FAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPK
    AANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris and NaCl.

Target

  • Target Protein
  • B3GAT1
  • Full Name
  • Beta-1,3-glucuronyltransferase 1
  • Introduction
  • The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized.
  • Alternative Names
  • B3GAT1; NK1; CD57; HNK1; LEU7; NK-1; GLCATP; GLCUATP; galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1; LEU7 antigen; UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase; glucuronosyltransferase P; Beta-1,3-glucuronyltransferase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us