Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human B4GALT7 (Beta-1,4-galactosyltransferase 7) Full Length (CAT#: MPC2767K) Made to Order

This product is a made-to-order Human B4GALT7 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • B4GALT7
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQ
    LSCSGDVARAVRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVP
    FRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFL
    ESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYV
    GGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGLQLFRPSGITT
    GYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
    SVGGAPCTVLNIMLDCDKTATPWCTFS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • B4GALT7
  • Full Name
  • Beta-1,4-galactosyltransferase 7
  • Introduction
  • This gene is a member of the beta-1,4-galactosyltransferase (beta4GalT) family. Family members encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose. Each beta4GalT member has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus which then remains uncleaved to function as a transmembrane anchor. The enzyme encoded by this gene attaches the first galactose in the common carbohydrate-protein linkage (GlcA-beta1,3-Gal-beta1,3-Gal-beta1,4-Xyl-beta1-O-Ser) found in proteoglycans. This enzyme differs from other beta4GalTs because it lacks the conserved Cys residues found in beta4GalT1-beta4GalT6 and it is located in cis-Golgi instead of trans-Golgi. Mutations in this gene have been associated with the progeroid form of Ehlers-Danlos syndrome.
  • Alternative Names
  • B4GALT7; XGPT; EDSP1; XGPT1; EDSSLA; XGALT1; EDSSPD1; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7; UDP-galactose:beta-xylose beta-1,4-galactosyltransferase; beta-1,4-GalTase 7; beta-1,4-galactosyltransferase VII; beta4Gal-T7; beta4GalT-VII; galactosyltransferase I; proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I; xylosylprotein 4-beta-galactosyltransferase; xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7; xylosylprotein beta-1,4-galactosyltransferase; Beta-1,4-galactosyltransferase 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us