Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BAMBI (BMP and activin membrane bound inhibitor) Expressed in NS0 for Antibody Discovery, Partial (27-152aa) (CAT#: MPX0198K)

This product is a 40.5 kDa Human BAMBI membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BAMBI
  • Protein Length
  • Partial (27-152aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 40.5 kDa
  • TMD
  • 1
  • Sequence
  • EIRCYCDAAHCVATGYMCKSELSA
    CFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCH
    EDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWF
    RA

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE with silver staining, under reducing conditions
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • BAMBI
  • Full Name
  • BMP and activin membrane bound inhibitor
  • Introduction
  • This gene encodes a transmembrane glycoprotein related to the type I receptors of the transforming growth factor-beta (TGF-beta) family, whose members play important roles in signal transduction in many developmental and pathological processes. The encoded protein however is a pseudoreceptor, lacking an intracellular serine/threonine kinase domain required for signaling. Similar proteins in frog, mouse and zebrafish function as negative regulators of TGF-beta, which has led to the suggestion that the encoded protein may function to limit the signaling range of the TGF-beta family during early embryogenesis.
  • Alternative Names
  • BAMBI; NMA; BMP and activin membrane-bound inhibitor homolog; non-metastatic gene A protein; putative transmembrane protein NMA; BMP and activin membrane bound inhibitor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us