Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human MAL2 (Mal, T cell differentiation protein 2) Full Length (CAT#: MPC2672K) Made to Order

This product is a made-to-order Human MAL2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • MAL2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 4
  • Sequence
  • MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLV
    WILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNF
    LDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINV
    AASIFAFMTTACYGCSLGLALRRWRP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • MAL2
  • Full Name
  • Mal, T cell differentiation protein 2
  • Introduction
  • This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface.
  • Alternative Names
  • MAL2; protein MAL2; MAL proteolipid protein 2; MAL2 proteolipid protein; myelin and lymphocyte protein 2; Mal, T cell differentiation protein 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us