Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BET1 (Bet1 golgi vesicular membrane trafficking protein) Full Length (CAT#: MPC4317K) Made to Order

This product is a made-to-order Human BET1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BET1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • TMD
  • 1
  • Sequence
  • MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLS
    IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM
    MLFSLFVFFIIYWIIKLR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • BET1
  • Full Name
  • Bet1 golgi vesicular membrane trafficking protein
  • Introduction
  • This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • BET1; HBET1; BET1 homolog; Bet1p homolog; Golgi vesicular membrane trafficking protein p18; blocked early in transport 1 homolog; golgi vesicular membrane-trafficking protein p18; Bet1 golgi vesicular membrane trafficking protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us