Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BOK (BCL2 family apoptosis regulator BOK) Full Length (CAT#: MPC2850K) Made to Order

This product is a made-to-order Human BOK membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BOK
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSW
    SAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP
    VVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALV
    DCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF
    LKAAFFVLLPER

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • BOK
  • Full Name
  • BCL2 family apoptosis regulator BOK
  • Introduction
  • The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.
  • Alternative Names
  • BOK; BOKL; BCL2L9; bcl-2-related ovarian killer protein; BCL2 related ovarian killer; BOK, BCL2 family apoptosis regulator; bcl-2-like protein 9; bcl2-L-9; hBOK; BCL2 family apoptosis regulator BOK

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us