Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BSG (Basigin (Ok blood group)) for Antibody Discovery (CAT#: MP1236J)

This product is a 22.6 kDa Human BSG membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BSG
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
  • Molecular Weight
  • 22.6 kDa
  • TMD
  • 1
  • Sequence
  • MKQSDASPQERVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV
    TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRS
    HLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • BSG
  • Full Name
  • Basigin (Ok blood group)
  • Introduction
  • The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • 5F7; CD147; EMMPRIN; EMPRIN; OK; SLC7A11; TCSF; OK blood group antigen; collagenase stimulatory factor; extracellular matrix metalloproteinase inducer; hepatoma-associated antigen; leukocyte activation antigen M6; tumor cell-derived collagenase stimulatory factor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us