Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BSG (Basigin (Ok blood group)) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (138-321aa) (CAT#: MPX4395K)

This product is a 24.2kDa Human BSG membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BSG
  • Protein Length
  • Partial (138-321aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 24.2kDa
  • TMD
  • 1
  • Sequence
  • EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • BSG
  • Full Name
  • Basigin (Ok blood group)
  • Introduction
  • The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN; SLC7A11; basigin; OK blood group antigen; collagenase stimulatory factor; extracellular matrix metalloproteinase inducer; hepatoma-associated antigen; leukocyte activation antigen M6; tumor cell-derived collagenase stimulatory factor; BSG; Basigin (Ok blood group)

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us