Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human NINJ2 (Ninjurin 2) Full Length (CAT#: MPC4369K) Made to Order

This product is a made-to-order Human NINJ2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • NINJ2
  • Protein Length
  • Full length
  • Protein Class
  • Cell adhesion
  • TMD
  • 2
  • Sequence
  • MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRL
    KAVLEQGPSSHYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWR
    LNQLNNAATILVFFTVVINVFITAFGAHKTGFLAARASRNPL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • NINJ2
  • Full Name
  • Ninjurin 2
  • Introduction
  • The protein encoded by this gene belongs to the ninjurin (for nerve injury induced) family. It is a cell surface adhesion protein that is upregulated in Schwann cells surrounding the distal segment of injured nerve, and promotes neurite outgrowth, thus may have a role in nerve regeneration after nerve injury.
  • Alternative Names
  • NINJ2; ninjurin-2; nerve injury-induced protein 2; Ninjurin 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us