Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BTN1A1 (Butyrophilin subfamily 1 member A1) Expressed in NS0 for Antibody Discovery, Partial (27-242aa) (CAT#: MPX0766K)

This product is a 25 kDa Human BTN1A1 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BTN1A1
  • Protein Length
  • Partial (27-242aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 25 kDa
  • TMD
  • 1
  • Sequence
  • APFDVIGPPEPILAVVGEDAELPC
    RLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQD
    GIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHI
    SMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLF
    TVAASVIIRDTSAKNVSCYIQNLLLGQEKKVEISIPASSLPR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • BTN1A1
  • Full Name
  • Butyrophilin subfamily 1 member A1
  • Introduction
  • Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.
  • Alternative Names
  • BTN1A1; BT; BTN; BTN1; bK14H9.2 (butyrophilin, subfamily 1, member A1); Butyrophilin subfamily 1 member A1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us