Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BTN3A3 (Butyrophilin subfamily 3 member A3) Expressed in CHO for Antibody Discovery, Partial (30-248aa) (CAT#: MPX0810K)

This product is a 24 kDa Human BTN3A3 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BTN3A3
  • Protein Length
  • Partial (30-248aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 24 kDa
  • TMD
  • 1
  • Sequence
  • QFSVLGPSGPILAMVGEDADL
    PCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSIL
    RDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDL
    HIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVG
    LYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • BTN3A3
  • Full Name
  • Butyrophilin subfamily 3 member A3
  • Introduction
  • The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A3) genes, which have undergone tandem duplication, resulting in 3 copies of each.
  • Alternative Names
  • BTN3A3; BTF3; BTN3.3; butyrophilin 3; Butyrophilin subfamily 3 member A3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us