Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human BTN3A1 (Butyrophilin subfamily 3 member A1) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (30-254aa) (CAT#: MPX4647K)

This product is a 40.2kDa Human BTN3A1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BTN3A1
  • Protein Length
  • Partial (30-254aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 40.2kDa
  • TMD
  • 1
  • Sequence
  • QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • BTN3A1
  • Full Name
  • Butyrophilin subfamily 3 member A1
  • Introduction
  • The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each.
  • Alternative Names
  • BTN3A1; BTF5; BT3.1; CD277; BTN3.1; dJ45P21.3 (butyrophilin, subfamily 3, member A1); Butyrophilin subfamily 3 member A1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us