Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human C4orf3 (Chromosome 4 open reading frame 3) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX0993K)

This product is a Human C4orf3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • C4orf3
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • C4orf3
  • Full Name
  • Chromosome 4 open reading frame 3
  • Alternative Names
  • C4orf3; ALN; HCVFTP1; uncharacterized protein C4orf3; HCV F-transactivated protein 1; another-regulin; hepatitis C virus F protein-transactivated protein 1; Chromosome 4 open reading frame 3

Case Studies

Customer reviews and Q&As    

Related Products
  • CAT
  • Product Name
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us