Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CACFD1 (Calcium channel flower domain containing 1) for Antibody Discovery (CAT#: MP0149X)

This product is a 44.9 kDa Human CACFD1 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CACFD1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 44.9 kDa
  • TMD
  • 3
  • Sequence
  • MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • CACFD1
  • Full Name
  • Calcium channel flower domain containing 1
  • Introduction
  • CACFD1 (Calcium Channel Flower Domain Containing 1) is a Protein Coding gene. Diseases associated with CACFD1 include Carey-Fineman-Ziter Syndrome and Myopathy, Areflexia, Respiratory Distress, And Dysphagia, Early-Onset. Among its related pathways are Transmission across Chemical Synapses and nNOS Signaling in Skeletal Muscle. Gene Ontology (GO) annotations related to this gene include calcium channel activity
  • Alternative Names
  • RP13-100B2.5; C9orf7; D9S2135; FLOWER; calcium channel flower domain-containing protein 1; calcium channel flower homolog

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us