Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CACNG1 (Calcium voltage-gated channel auxiliary subunit gamma 1) Full Length (CAT#: MPC2269K) Made to Order

This product is a 25 kDa Human CACNG1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CACNG1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 25 kDa
  • TMD
  • 4
  • Sequence
  • MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAH
    FGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQ
    KEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPASMFYAFAGLC
    ILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALL
    LFSLPRMPRNPWESCMDAEPEH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CACNG1
  • Full Name
  • Calcium voltage-gated channel auxiliary subunit gamma 1
  • Introduction
  • Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs).
  • Alternative Names
  • CACNG1; CACNLG; voltage-dependent calcium channel gamma-1 subunit; L-type calcium channel gamma polypeptide; calcium channel, voltage-dependent, gamma subunit 1; dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma; neuronal dihydropyridine-sensitive calcium channel gamma subunit; Calcium voltage-gated channel auxiliary subunit gamma 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us