Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CACNG7 (Calcium voltage-gated channel auxiliary subunit gamma 7) Full Length (CAT#: MPC0442K) Made to Order

This product is a 31 kDa Human CACNG7 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CACNG7
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 31 kDa
  • TMD
  • 4
  • Sequence
  • MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEV
    KMALHAGLWRVCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTA
    TPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLV
    LYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLF
    TKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDV
    SIQMTQNYPPAIKYPDHLHISTSPC

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CACNG7
  • Full Name
  • Calcium voltage-gated channel auxiliary subunit gamma 7
  • Introduction
  • The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit.
  • Alternative Names
  • voltage-dependent calcium channel gamma-7 subunit; TARP gamma-7; calcium channel, voltage-dependent, gamma subunit 7; neuronal voltage-gated calcium channel gamma-7 subunit; transmembrane AMPAR regulatory protein gamma-7; CACNG7; Calcium voltage-gated channel auxiliary subunit gamma 7

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us