Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CALY (Calcyon neuron specific vesicular protein) Full Length (CAT#: MPC2960K) Made to Order

This product is a made-to-order Human CALY membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CALY
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKT
    QTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVL
    IMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGA
    YPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAE
    KEAARKAAGSAAPPPAQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • CALY
  • Full Name
  • Calcyon neuron specific vesicular protein
  • Introduction
  • The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs.
  • Alternative Names
  • CALY; NSG3; DRD1IP; neuron-specific vesicular protein calcyon; D1 dopamine receptor-interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); calcyon protein; dopamine receptor D1 interacting protein; Calcyon neuron specific vesicular protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us