Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CCL15 (C-C motif chemokine ligand 15, ) for Antibody Discovery (CAT#: MP1178J)

This product is a 12.7 kDa Human CCL15 membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCL15
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 12.7 kDa
  • Sequence
  • MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY
    FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Target

  • Target Protein
  • CCL15
  • Full Name
  • C-C motif chemokine ligand 15
  • Introduction
  • This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14).
  • Alternative Names
  • LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; SCYL3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; MIP-1 delta

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us