Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CCR10 (C-C motif chemokine receptor 10) Full Length (CAT#: MPC0057K) Made to Order

This product is a 38.4 kDa Human CCR10 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR10
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 38.4 kDa
  • TMD
  • 7
  • Sequence
  • MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLT
    VAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAA
    GALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGP
    RPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLT
    QTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVV
    ALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
    ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCS
    APTETHSLSWDN

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CCR10
  • Full Name
  • C-C motif chemokine receptor 10
  • Introduction
  • Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27; MIM 604833); CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation
  • Alternative Names
  • GPR2; C-C chemokine receptor type 10; C-C CKR-10; CC chemokine receptor 10; CC-CKR-10; CCR-10; G-protein coupled receptor 2; chemokine (C-C motif) receptor 10; CCR10; C-C motif chemokine receptor 10

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us