Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CCR2 (C-C motif chemokine receptor 2) Full Length (CAT#: MPC0049K) Made to Order

This product is a 41.9 kDa Human CCR2 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR2
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 41.9 kDa
  • TMD
  • 7
  • Sequence
  • MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYS
    LVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAH
    SAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALK
    ARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNN
    FHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMI
    VYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI
    NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL
    LDGRGKGKSIGRAPEASLQDKEGA

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Flag tag at N-terminal and 10xHis tag and another FLAG tag at C-terminal
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • CCR2
  • Full Name
  • C-C motif chemokine receptor 2
  • Introduction
  • The protein encoded by this gene is a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The encoded protein mediates agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This protein can also be a coreceptor with CD4 for HIV-1 infection. This gene is located in the chemokine receptor gene cluster region of chromosome 3.
  • Alternative Names
  • CKR2; CCR-2; CCR2A; CCR2B; CD192; CKR2A; CKR2B; CMKBR2; MCP-1-R; CC-CKR-2; C-C chemokine receptor type 2; MCP-1 receptor; chemokine (C-C motif) receptor 2; monocyte chemoattractant protein 1 receptor; monocyte chemotactic protein 1 receptor; CCR2; C-C motif chemokine receptor 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us