Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CCRL2 (C-C motif chemokine receptor like 2) for Antibody Discovery (CAT#: MP1339J)

This product is a 39.5 kDa Human CCRL2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCRL2
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 39.5 kDa
  • TMD
  • 7
  • Sequence
  • MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVV LILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFF NCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYK CAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLV FAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCRL2
  • Full Name
  • C-C motif chemokine receptor like 2
  • Introduction
  • This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located.
  • Alternative Names
  • C-C chemokine receptor-like 2; CCRL2; CCRL2_HUMAN; Chemokine (C-C motif) receptor like 2; Chemokine receptor CCR11; Chemokine receptor X; CKRX; CRAM A; CRAM B; CRAMA; CRAMB; FLJ55815; HCR; MGC116710; MGC34104; Putative MCP 1 chemokine receptor; Putative MCP-1 chemokine receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us