Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human CD164 (CD164 molecule) Expressed in NS0 for Antibody Discovery, Partial (24-160aa) (CAT#: MPX0484K)

This product is a 41 kDa Human CD164 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD164
  • Protein Length
  • Partial (24-160aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 41 kDa
  • TMD
  • 1
  • Sequence
  • DKNTTQHPNVTTLAPISNVTSAPVTSL
    PLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDC
    QVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVT
    PTSQPVRKST

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in water.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in MES and NaCl.

Target

  • Target Protein
  • CD164
  • Full Name
  • CD164 molecule
  • Introduction
  • This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing.
  • Alternative Names
  • CD164; DFNA66; MGC-24; MUC-24; MGC-24v; endolyn; sialomucin core protein 24; CD164 antigen, sialomucin; multi-glycosylated core protein 24; CD164 molecule

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us